PDB entry 1is7

View 1is7 on RCSB PDB site
Description: crystal structure of rat gtpchi/gfrp stimulatory complex
Deposited on 2001-11-18, released 2002-02-20
The last revision prior to the SCOP 1.67 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1is7a_
  • Chain 'B':
    Domains in SCOP 1.67: d1is7b_
  • Chain 'C':
    Domains in SCOP 1.67: d1is7c_
  • Chain 'D':
    Domains in SCOP 1.67: d1is7d_
  • Chain 'E':
    Domains in SCOP 1.67: d1is7e_
  • Chain 'F':
    Domains in SCOP 1.67: d1is7f_
  • Chain 'G':
    Domains in SCOP 1.67: d1is7g_
  • Chain 'H':
    Domains in SCOP 1.67: d1is7h_
  • Chain 'I':
    Domains in SCOP 1.67: d1is7i_
  • Chain 'J':
    Domains in SCOP 1.67: d1is7j_
  • Chain 'K':
    Domains in SCOP 1.67: d1is7k_
  • Chain 'L':
    Domains in SCOP 1.67: d1is7l_
  • Chain 'M':
    Domains in SCOP 1.67: d1is7m_
  • Chain 'N':
    Domains in SCOP 1.67: d1is7n_
  • Chain 'O':
    Domains in SCOP 1.67: d1is7o_
  • Chain 'P':
    Domains in SCOP 1.67: d1is7p_
  • Chain 'Q':
    Domains in SCOP 1.67: d1is7q_
  • Chain 'R':
    Domains in SCOP 1.67: d1is7r_
  • Chain 'S':
    Domains in SCOP 1.67: d1is7s_
  • Chain 'T':
    Domains in SCOP 1.67: d1is7t_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1is7A (A:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7A (A:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1is7B (B:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7B (B:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1is7C (C:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7C (C:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1is7D (D:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7D (D:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1is7E (E:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7E (E:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1is7F (F:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7F (F:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1is7G (G:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7G (G:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1is7H (H:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7H (H:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1is7I (I:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7I (I:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1is7J (J:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1is7J (J:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7K (K:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7L (L:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7M (M:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7N (N:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7O (O:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7P (P:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7Q (Q:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7R (R:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7S (S:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1is7T (T:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke