SCOPe 2.08: Domain d1iqca1: 1iqc A:1-150

Lineage for d1iqca1 (1iqc A:1-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
   duplication: contains two cytochrome c-type domains

6. Protein Di-heme cytochrome c peroxidase [46686] (3 species)

7. Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)

8. Domain d1iqca1: 1iqc A:1-150 [66266]
   complexed with ca, gol, hec, mg

Details for d1iqca1

PDB Entry: 1iqc, 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea

PDB Compounds: (A:) di-heme peroxidase

SCOPe Domain Sequences for d1iqca1:

Sequence; same for both SEQRES and ATOM records:

>d1iqca1 a.3.1.5 (A:1-150) Di-heme cytochrome c peroxidase {Nitrosomonas europaea [TaxId: 915]}
anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
rerfkkvfgsdevtidrittaiaqfeetlv

Timeline for d1iqca1:

• d1iqca1 first appeared in SCOP 1.59
  
• d1iqca1 appears in SCOPe 2.07