Lineage for d1iqcd1 (1iqc D:1-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691549Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 2691550Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 2691551Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)
  8. 2691558Domain d1iqcd1: 1iqc D:1-150 [66272]
    complexed with ca, gol, hec, mg

Details for d1iqcd1

PDB Entry: 1iqc (more details), 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea
PDB Compounds: (D:) di-heme peroxidase

SCOPe Domain Sequences for d1iqcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqcd1 a.3.1.5 (D:1-150) Di-heme cytochrome c peroxidase {Nitrosomonas europaea [TaxId: 915]}
anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
rerfkkvfgsdevtidrittaiaqfeetlv

SCOPe Domain Coordinates for d1iqcd1:

Click to download the PDB-style file with coordinates for d1iqcd1.
(The format of our PDB-style files is described here.)

Timeline for d1iqcd1: