SCOPe 2.07: Domain d1ik9b1: 1ik9 B:1-117

Lineage for d1ik9b1 (1ik9 B:1-117)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.59: XRCC4, N-terminal domain [50808] (1 superfamily)
   barrel, closed; n=7, S=10; order: 1234765; strands 1 and 5 are parallel to each other

4. Superfamily b.59.1: XRCC4, N-terminal domain [50809] (1 family)
   an HTH motif connects strands 4 and 5

5. Family b.59.1.1: XRCC4, N-terminal domain [50810] (2 proteins)

6. Protein XRCC4, N-terminal domain [50811] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50812] (4 PDB entries)

8. Domain d1ik9b1: 1ik9 B:1-117 [66178]
   Other proteins in same PDB: d1ik9a2, d1ik9b2
   complexed with a DNA ligase IV peptide
   protein/DNA complex

Details for d1ik9b1

PDB Entry: 1ik9, 2.3 Å

PDB Description: crystal structure of a xrcc4-dna ligase iv complex

PDB Compounds: (B:) DNA repair protein xrcc4

SCOPe Domain Sequences for d1ik9b1:

Sequence, based on SEQRES records:

>d1ik9b1 b.59.1.1 (B:1-117) XRCC4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddma
mekgkyvgelrkallsgagpadvytfnfskesayfffeknlkdvsfrlgsfnlekve

Sequence, based on observed residues (ATOM records):

>d1ik9b1 b.59.1.1 (B:1-117) XRCC4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddma
mekgkyvgelrkallsvytfnfskesayfffeknlkdvsfrlgsfnlekve

Timeline for d1ik9b1:

• d1ik9b1 first appeared in SCOP 1.59
  
• d1ik9b1 appears in SCOPe 2.06
  
• d1ik9b1 appears in the current release, SCOPe 2.08