Lineage for d1ik9b1 (1ik9 B:1-117)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062508Fold b.59: XRCC4, N-terminal domain [50808] (1 superfamily)
    barrel, closed; n=7, S=10; order: 1234765; strands 1 and 5 are parallel to each other
  4. 2062509Superfamily b.59.1: XRCC4, N-terminal domain [50809] (1 family) (S)
    an HTH motif connects strands 4 and 5
  5. 2062510Family b.59.1.1: XRCC4, N-terminal domain [50810] (1 protein)
  6. 2062511Protein XRCC4, N-terminal domain [50811] (1 species)
  7. 2062512Species Human (Homo sapiens) [TaxId:9606] [50812] (3 PDB entries)
  8. 2062514Domain d1ik9b1: 1ik9 B:1-117 [66178]
    Other proteins in same PDB: d1ik9a2, d1ik9b2
    complexed with a DNA ligase IV peptide
    protein/DNA complex

Details for d1ik9b1

PDB Entry: 1ik9 (more details), 2.3 Å

PDB Description: crystal structure of a xrcc4-dna ligase iv complex
PDB Compounds: (B:) DNA repair protein xrcc4

SCOPe Domain Sequences for d1ik9b1:

Sequence, based on SEQRES records: (download)

>d1ik9b1 b.59.1.1 (B:1-117) XRCC4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddma
mekgkyvgelrkallsgagpadvytfnfskesayfffeknlkdvsfrlgsfnlekve

Sequence, based on observed residues (ATOM records): (download)

>d1ik9b1 b.59.1.1 (B:1-117) XRCC4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddma
mekgkyvgelrkallsvytfnfskesayfffeknlkdvsfrlgsfnlekve

SCOPe Domain Coordinates for d1ik9b1:

Click to download the PDB-style file with coordinates for d1ik9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ik9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ik9b2