Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.11: XRCC4, C-terminal oligomerization domain [58022] (1 family) |
Family h.1.11.1: XRCC4, C-terminal oligomerization domain [58023] (1 protein) |
Protein XRCC4, C-terminal oligomerization domain [58024] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [58025] (3 PDB entries) |
Domain d1ik9a2: 1ik9 A:118-211 [66177] Other proteins in same PDB: d1ik9a1, d1ik9b1 complexed with a DNA ligase IV peptide protein/DNA complex |
PDB Entry: 1ik9 (more details), 2.3 Å
SCOPe Domain Sequences for d1ik9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ik9a2 h.1.11.1 (A:118-211) XRCC4, C-terminal oligomerization domain {Human (Homo sapiens) [TaxId: 9606]} npaevireliayaldtiaenqaknehlqkenerllrdwndvqgrfekavsakealetdly krfilvlnekktkirslhnkllnaaqerekdikq
Timeline for d1ik9a2: