Lineage for d1ik9a2 (1ik9 A:118-211)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040131Superfamily h.1.11: XRCC4, C-terminal oligomerization domain [58022] (2 families) (S)
  5. 3040132Family h.1.11.1: XRCC4, C-terminal oligomerization domain [58023] (1 protein)
  6. 3040133Protein XRCC4, C-terminal oligomerization domain [58024] (1 species)
  7. 3040134Species Human (Homo sapiens) [TaxId:9606] [58025] (4 PDB entries)
  8. 3040135Domain d1ik9a2: 1ik9 A:118-211 [66177]
    Other proteins in same PDB: d1ik9a1, d1ik9b1
    complexed with a DNA ligase IV peptide
    protein/DNA complex

Details for d1ik9a2

PDB Entry: 1ik9 (more details), 2.3 Å

PDB Description: crystal structure of a xrcc4-dna ligase iv complex
PDB Compounds: (A:) DNA repair protein xrcc4

SCOPe Domain Sequences for d1ik9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ik9a2 h.1.11.1 (A:118-211) XRCC4, C-terminal oligomerization domain {Human (Homo sapiens) [TaxId: 9606]}
npaevireliayaldtiaenqaknehlqkenerllrdwndvqgrfekavsakealetdly
krfilvlnekktkirslhnkllnaaqerekdikq

SCOPe Domain Coordinates for d1ik9a2:

Click to download the PDB-style file with coordinates for d1ik9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ik9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ik9a1