Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain [52279] (1 family) |
Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain [52280] (1 protein) |
Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (1 species) interdomain linker forms an additional, N-terminal strand |
Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (9 PDB entries) |
Domain d1ieqa2: 1ieq A:389-602 [66122] Other proteins in same PDB: d1ieqa1 complexed with fuc, glc, man, nag |
PDB Entry: 1ieq (more details), 2.7 Å
SCOP Domain Sequences for d1ieqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieqa2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp rtwfksvdqlpmnvgdahydplfrlgyglttnat
Timeline for d1ieqa2: