Lineage for d1ieqa2 (1ieq A:389-602)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857584Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2857585Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins)
  6. 2857586Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (2 species)
    interdomain linker forms an additional, N-terminal strand
  7. 2857587Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (9 PDB entries)
  8. 2857594Domain d1ieqa2: 1ieq A:389-602 [66122]
    Other proteins in same PDB: d1ieqa1
    complexed with bgc

Details for d1ieqa2

PDB Entry: 1ieq (more details), 2.7 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1
PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo1

SCOPe Domain Sequences for d1ieqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieqa2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

SCOPe Domain Coordinates for d1ieqa2:

Click to download the PDB-style file with coordinates for d1ieqa2.
(The format of our PDB-style files is described here.)

Timeline for d1ieqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ieqa1