PDB entry 1ieq

View 1ieq on RCSB PDB site
Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1
Class: hydrolase
Keywords: 2-domain fold
Deposited on 2001-04-11, released 2001-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-d-glucan glucohydrolase isoenzyme exo1
    Species: HORDEUM VULGARE
    Database cross-references and differences (RAF-indexed):
    • GB AAD23382 (0-End)
      • see remark 999 (319)
    Domains in SCOP 1.75: d1ieqa1, d1ieqa2
  • Heterogens: GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ieqA (A:)
    dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
    prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
    pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
    qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
    amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
    sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
    npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
    dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
    ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
    vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
    atkky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ieqA (A:)
    dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
    prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
    pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
    qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
    amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
    sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
    npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
    dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
    ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
    vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
    at