Lineage for d1ieqa2 (1ieq A:389-602)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178021Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain [52279] (1 family) (S)
  5. 178022Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain [52280] (1 protein)
  6. 178023Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (1 species)
  7. 178024Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (6 PDB entries)
  8. 178029Domain d1ieqa2: 1ieq A:389-602 [66122]
    Other proteins in same PDB: d1ieqa1

Details for d1ieqa2

PDB Entry: 1ieq (more details), 2.7 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1

SCOP Domain Sequences for d1ieqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieqa2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare)}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

SCOP Domain Coordinates for d1ieqa2:

Click to download the PDB-style file with coordinates for d1ieqa2.
(The format of our PDB-style files is described here.)

Timeline for d1ieqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ieqa1