Lineage for d1id3f_ (1id3 F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151058Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 151059Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 151060Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 151110Protein Histone H4 [47125] (4 species)
  7. 151114Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [68987] (1 PDB entry)
  8. 151116Domain d1id3f_: 1id3 F: [66117]
    Other proteins in same PDB: d1id3a_, d1id3c_, d1id3d_, d1id3e_, d1id3g_, d1id3h_

Details for d1id3f_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions

SCOP Domain Sequences for d1id3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3f_ a.22.1.1 (F:) Histone H4 {Baker's yeast (Saccharomyces cerevisiae)}
hrkilrdniqgitkpairrlarrggvkrisgliyeevravlksflesvirdsvtytehak
rktvtsldvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1id3f_:

Click to download the PDB-style file with coordinates for d1id3f_.
(The format of our PDB-style files is described here.)

Timeline for d1id3f_: