SCOP 1.61: Domain d1id3h_: 1id3 H:

Lineage for d1id3h_ (1id3 H:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)

6. Protein Histone H2B [47119] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId:4932] [68985] (1 PDB entry)

8. Domain d1id3h_: 1id3 H: [66119]
   Other proteins in same PDB: d1id3a_, d1id3b_, d1id3c_, d1id3e_, d1id3f_, d1id3g_

Details for d1id3h_

PDB Entry: 1id3, 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions

SCOP Domain Sequences for d1id3h_:

Sequence; same for both SEQRES and ATOM records:

>d1id3h_ a.22.1.1 (H:) Histone H2B {Baker's yeast (Saccharomyces cerevisiae), H2B.2}
vrketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisa
reiqtavrlilpgelakhavsegtravtkyssstqa

Timeline for d1id3h_:

• d1id3h_ first appeared in SCOP 1.59
  
• d1id3h_ appears in SCOP 1.63
  
• d1id3h_ appears in the current release, SCOPe 2.08