Lineage for d1id3d_ (1id3 D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764911Protein Histone H2B [47119] (6 species)
  7. 764965Species Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId:4932] [68985] (2 PDB entries)
  8. 764966Domain d1id3d_: 1id3 D: [66115]
    Other proteins in same PDB: d1id3a_, d1id3b_, d1id3c_, d1id3e_, d1id3f_, d1id3g_

Details for d1id3d_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
PDB Compounds: (D:) histone h2b.2

SCOP Domain Sequences for d1id3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3d_ a.22.1.1 (D:) Histone H2B {Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId: 4932]}
rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar
eiqtavrlilpgelakhavsegtravtkyssst

SCOP Domain Coordinates for d1id3d_:

Click to download the PDB-style file with coordinates for d1id3d_.
(The format of our PDB-style files is described here.)

Timeline for d1id3d_: