Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [68986] (1 PDB entry) |
Domain d1id3a_: 1id3 A: [66112] Other proteins in same PDB: d1id3b_, d1id3c_, d1id3d_, d1id3f_, d1id3g_, d1id3h_ |
PDB Entry: 1id3 (more details), 3.1 Å
SCOP Domain Sequences for d1id3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1id3a_ a.22.1.1 (A:) Histone H3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} phrykpgtvalreirrfqkstellirklpfqrlvreiaqdfktdlrfqssaigalqesve aylvslfedtnlaaihakrvtiqkkeiklarrlrger
Timeline for d1id3a_: