Lineage for d1id0a_ (1id0 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) 
Family d.122.1.3: Histidine kinase [55884] (3 proteins) Protein Histidine kinase PhoQ domain [69802] (1 species) Species Escherichia coli [TaxId:562] [69803] (1 PDB entry) 
Domain d1id0a_: 1id0 A: [66111]
Details for d1id0a_
PDB Entry: 1id0 (more details), 1.6 Å
PDB Description: crystal structure of the nucleotide bond conformation of phoq kinase domain
SCOP Domain Sequences for d1id0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli}
relhpvaplldnltsalnkvyqrkgvnisldispeisfvgeqndfvevmgnvldnackyc
lefveisarqtdehlyivveddgpgiplskrevifdrgqrvdtlrpgqgvglavareite
qyegkivagesmlggarmevifgrqh
SCOP Domain Coordinates for d1id0a_:
Click to download the PDB-style file with coordinates for d1id0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1id0a_:
- d1id0a_ is new in SCOP 1.59
- d1id0a_ appears in SCOP 1.61
- d1id0a_ appears in the current release, SCOPe 2.08
View in 3D