Lineage for d1id0a_ (1id0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973838Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2973878Protein Histidine kinase PhoQ domain [69802] (1 species)
  7. 2973879Species Escherichia coli [TaxId:562] [69803] (1 PDB entry)
  8. 2973880Domain d1id0a_: 1id0 A: [66111]
    complexed with anp, mg

Details for d1id0a_

PDB Entry: 1id0 (more details), 1.6 Å

PDB Description: crystal structure of the nucleotide bond conformation of phoq kinase domain
PDB Compounds: (A:) phoq histidine kinase

SCOPe Domain Sequences for d1id0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]}
relhpvaplldnltsalnkvyqrkgvnisldispeisfvgeqndfvevmgnvldnackyc
lefveisarqtdehlyivveddgpgiplskrevifdrgqrvdtlrpgqgvglavareite
qyegkivagesmlggarmevifgrqh

SCOPe Domain Coordinates for d1id0a_:

Click to download the PDB-style file with coordinates for d1id0a_.
(The format of our PDB-style files is described here.)

Timeline for d1id0a_: