![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
![]() | Family c.4.1.3: UDP-galactopyranose mutase, N-terminal domain [69427] (1 protein) domain structure is similar to that of D-aminoacid oxidase |
![]() | Protein UDP-galactopyranose mutase, N-terminal domain [69428] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69429] (1 PDB entry) |
![]() | Domain d1i8tb1: 1i8t B:1-244,B:314-367 [66096] Other proteins in same PDB: d1i8ta2, d1i8tb2 complexed with fad; mutant |
PDB Entry: 1i8t (more details), 2.4 Å
SCOP Domain Sequences for d1i8tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8tb1 c.4.1.3 (B:1-244,B:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli} mydyiivgsglfgavcanelkklnkkvlviekrnhiggnaytedcegiqihkygahifht ndkyiwdyvndlvefnrftnsplaiykdklfnlpfnmntfhqmwgvkdpqeaqniinaqk kkygdkvpenleeqaislvgedlyqalikgytekqwgrsakelpafiikripvrftfdnn yfsdryqgipvggytkliekmlegvdvklgidflkdkdslaskahriiytgpidqyfdyr fgalXndnknmelfkkyrelasredkvifggrlaeykyydmhqvisaalyqvknimstd
Timeline for d1i8tb1: