Lineage for d1i8ta2 (1i8t A:245-313)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 254680Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 254681Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 254860Family d.16.1.7: UDP-galactopyranose mutases [69670] (1 protein)
  6. 254861Protein UDP-galactopyranose mutases [69671] (1 species)
  7. 254862Species Escherichia coli [TaxId:562] [69672] (1 PDB entry)
  8. 254863Domain d1i8ta2: 1i8t A:245-313 [66095]
    Other proteins in same PDB: d1i8ta1, d1i8tb1

Details for d1i8ta2

PDB Entry: 1i8t (more details), 2.4 Å

PDB Description: structure of udp-galactopyranose mutase from e.coli

SCOP Domain Sequences for d1i8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8ta2 d.16.1.7 (A:245-313) UDP-galactopyranose mutases {Escherichia coli}
eyrslkfeterhefpnfqgnavinftdanvpytriiehkhfdyvetkhtvvtkeyplewk
vgdepyypv

SCOP Domain Coordinates for d1i8ta2:

Click to download the PDB-style file with coordinates for d1i8ta2.
(The format of our PDB-style files is described here.)

Timeline for d1i8ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i8ta1