SCOPe 2.02: Domain d1i6ea_: 1i6e A:

Lineage for d1i6ea_ (1i6e A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c552 [46636] (5 species)

7. Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries)

8. Domain d1i6ea_: 1i6e A: [66039]
   complexed with hec

Details for d1i6ea_

PDB Entry: 1i6e

PDB Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the oxidized state

PDB Compounds: (A:) cytochrome c552

SCOPe Domain Sequences for d1i6ea_:

Sequence; same for both SEQRES and ATOM records:

>d1i6ea_ a.3.1.1 (A:) Cytochrome c552 {Paracoccus denitrificans [TaxId: 266]}
madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
alqefltnpkavvkgtkmafaglpkiedranliaylegqq

Timeline for d1i6ea_:

• d1i6ea_ first appeared in SCOP 1.59
  
• d1i6ea_ appears in SCOPe 2.01
  
• d1i6ea_ appears in SCOPe 2.03
  
• d1i6ea_ appears in the current release, SCOPe 2.08