Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c552 [46636] (5 species) |
Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries) |
Domain d1i6ea_: 1i6e A: [66039] complexed with hec |
PDB Entry: 1i6e (more details)
SCOPe Domain Sequences for d1i6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6ea_ a.3.1.1 (A:) Cytochrome c552 {Paracoccus denitrificans [TaxId: 266]} madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe alqefltnpkavvkgtkmafaglpkiedranliaylegqq
Timeline for d1i6ea_: