Lineage for d1i51.1 (1i51 A:,B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1355509Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 1355510Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 1355511Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)
  6. 1355561Protein Caspase-7 [63961] (1 species)
  7. 1355562Species Human (Homo sapiens) [TaxId:9606] [63962] (11 PDB entries)
    Uniprot P55210 57-303
  8. 1355571Domain d1i51.1: 1i51 A:,B: [66029]
    Other proteins in same PDB: d1i51e_, d1i51f_
    complexed to the xiap-bir2 fragment (chains E and F)

Details for d1i51.1

PDB Entry: 1i51 (more details), 2.45 Å

PDB Description: crystal structure of caspase-7 complexed with xiap
PDB Compounds: (A:) caspase-7 subunit p20, (B:) caspase-7 subunit p11

SCOPe Domain Sequences for d1i51.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1i51.1 c.17.1.1 (A:,B:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca
kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktllek
pklffiqacrgtelddgiqXkipveadflfaystvpgyyswrspgrgswfvqalcsilee
hgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq

SCOPe Domain Coordinates for d1i51.1:

Click to download the PDB-style file with coordinates for d1i51.1.
(The format of our PDB-style files is described here.)

Timeline for d1i51.1: