Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (3 families) mature protein may be composed of two chains folded in a single domain |
Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins) |
Protein Caspase-7 [63961] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63962] (12 PDB entries) Uniprot P55210 57-303 |
Domain d1i51.1: 1i51 A:,B: [66029] Other proteins in same PDB: d1i51e_, d1i51f_ complexed to the xiap-bir2 fragment (chains E and F) |
PDB Entry: 1i51 (more details), 2.45 Å
SCOPe Domain Sequences for d1i51.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1i51.1 c.17.1.1 (A:,B:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktllek pklffiqacrgtelddgiqXkipveadflfaystvpgyyswrspgrgswfvqalcsilee hgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq
Timeline for d1i51.1: