PDB entry 1i51

View 1i51 on RCSB PDB site
Description: crystal structure of caspase-7 complexed with xiap
Class: hydrolase/hydrolase inhibitor
Keywords: protease, caspase, IAP, apoptosis, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2001-02-23, released 2002-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.233
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-7 subunit p20
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55210
      • engineered (118)
    Domains in SCOPe 2.07: d1i51.1
  • Chain 'B':
    Compound: caspase-7 subunit p11
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i51.1
  • Chain 'C':
    Compound: caspase-7 subunit p20
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55210
      • engineered (118)
    Domains in SCOPe 2.07: d1i51.2
  • Chain 'D':
    Compound: caspase-7 subunit p11
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i51.2
  • Chain 'E':
    Compound: x-linked inhibitor of apotosis protein
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i51e_
  • Chain 'F':
    Compound: x-linked inhibitor of apotosis protein
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i51f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i51A (A:)
    trdrvptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdviv
    yndcscakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgar
    cktllekpklffiqacrgtelddgiqad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i51A (A:)
    yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca
    kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktllek
    pklffiqacrgtelddgiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i51B (B:)
    sgpindtdanprykipveadflfaystvpgyyswrspgrgswfvqalcsileehgkdlei
    mqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i51B (B:)
    kipveadflfaystvpgyyswrspgrgswfvqalcsileehgkdleimqiltrvndrvar
    hfesqsddphfhekkqipcvvsmltkelyfsq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i51C (C:)
    trdrvptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdviv
    yndcscakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgar
    cktllekpklffiqacrgtelddgiqad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i51C (C:)
    yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca
    kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktllek
    pklffiqacrgtelddgiq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i51D (D:)
    sgpindtdanprykipveadflfaystvpgyyswrspgrgswfvqalcsileehgkdlei
    mqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i51D (D:)
    kipveadflfaystvpgyyswrspgrgswfvqalcsileehgkdleimqiltrvndrvar
    hfesqsddphfhekkqipcvvsmltkelyfsq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i51E (E:)
    rdhfaldrpsethadyllrtgqvvdisdtiyprnpamyceearlksfqnwpdyahltpre
    lasaglyytgigdqvqcfccggklknwepcdrawsehrrhfpncffvlgrnlnirse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i51E (E:)
    thadyllrtgqvvdisdt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1i51F (F:)
    rdhfaldrpsethadyllrtgqvvdisdtiyprnpamyceearlksfqnwpdyahltpre
    lasaglyytgigdqvqcfccggklknwepcdrawsehrrhfpncffvlgrnlnirse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i51F (F:)
    thadyllrtgqvvdisdt