SCOPe 2.04: Domain d1i51.1: 1i51 A:,B:

Lineage for d1i51.1 (1i51 A:,B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)

6. Protein Caspase-7 [63961] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63962] (12 PDB entries)
   Uniprot P55210 57-303

8. Domain d1i51.1: 1i51 A:,B: [66029]
   Other proteins in same PDB: d1i51e_, d1i51f_
   complexed to the xiap-bir2 fragment (chains E and F)

Details for d1i51.1

PDB Entry: 1i51, 2.45 Å

PDB Description: crystal structure of caspase-7 complexed with xiap

PDB Compounds: (A:) caspase-7 subunit p20, (B:) caspase-7 subunit p11

SCOPe Domain Sequences for d1i51.1:

Sequence; same for both SEQRES and ATOM records:

>g1i51.1 c.17.1.1 (A:,B:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca
kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktllek
pklffiqacrgtelddgiqXkipveadflfaystvpgyyswrspgrgswfvqalcsilee
hgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq

Timeline for d1i51.1:

• d1i51.1 first appeared in SCOP 1.59
  
• d1i51.1 appears in SCOPe 2.03
  
• d1i51.1 appears in SCOPe 2.05
  
• d1i51.1 appears in the current release, SCOPe 2.08