Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
Species Escherichia coli [TaxId:562] [56259] (8 PDB entries) |
Domain d1ht1a_: 1ht1 A: [65924] Other proteins in same PDB: d1ht1e1, d1ht1e2, d1ht1f1, d1ht1f2, d1ht1g1, d1ht1g2, d1ht1i1, d1ht1i2 complexed with adp |
PDB Entry: 1ht1 (more details), 2.8 Å
SCOPe Domain Sequences for d1ht1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ht1a_ d.153.1.4 (A:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d1ht1a_: