![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
![]() | Protein Homoserine kinase [54233] (1 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries) |
![]() | Domain d1h74b1: 1h74 B:5-167 [65693] Other proteins in same PDB: d1h74a2, d1h74b2, d1h74c2, d1h74d2 complexed with adp, ags, ile, mg |
PDB Entry: 1h74 (more details), 1.9 Å
SCOPe Domain Sequences for d1h74b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h74b1 d.14.1.5 (B:5-167) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]} mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd yasygelassgakhadnvapaifggftmvtnyeplevlhipid
Timeline for d1h74b1: