Lineage for d1h74d2 (1h74 D:168-300)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954566Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954567Family d.58.26.1: Homoserine kinase [55061] (1 protein)
  6. 2954568Protein Homoserine kinase [55062] (1 species)
  7. 2954569Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 2954578Domain d1h74d2: 1h74 D:168-300 [65698]
    Other proteins in same PDB: d1h74a1, d1h74b1, d1h74c1, d1h74d1
    complexed with adp, ags, ile, mg

Details for d1h74d2

PDB Entry: 1h74 (more details), 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile
PDB Compounds: (D:) homoserine kinase

SCOPe Domain Sequences for d1h74d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h74d2 d.58.26.1 (D:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOPe Domain Coordinates for d1h74d2:

Click to download the PDB-style file with coordinates for d1h74d2.
(The format of our PDB-style files is described here.)

Timeline for d1h74d2: