Lineage for d1h74a2 (1h74 A:168-300)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192764Superfamily d.58.26: GHMP Kinase [55060] (4 families) (S)
  5. 192765Family d.58.26.1: Homoserine kinase, C-terminal domain [55061] (1 protein)
  6. 192766Protein Homoserine kinase, C-terminal domain [55062] (1 species)
  7. 192767Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 192770Domain d1h74a2: 1h74 A:168-300 [65692]
    Other proteins in same PDB: d1h74a1, d1h74b1, d1h74c1, d1h74d1

Details for d1h74a2

PDB Entry: 1h74 (more details), 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile

SCOP Domain Sequences for d1h74a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h74a2 d.58.26.1 (A:168-300) Homoserine kinase, C-terminal domain {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOP Domain Coordinates for d1h74a2:

Click to download the PDB-style file with coordinates for d1h74a2.
(The format of our PDB-style files is described here.)

Timeline for d1h74a2: