![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) ![]() |
![]() | Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (4 proteins) |
![]() | Protein Homoserine kinase [54233] (1 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries) |
![]() | Domain d1h74d1: 1h74 D:5-167 [65697] Other proteins in same PDB: d1h74a2, d1h74b2, d1h74c2, d1h74d2 |
PDB Entry: 1h74 (more details), 1.9 Å
SCOP Domain Sequences for d1h74d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h74d1 d.14.1.5 (D:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii} mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd yasygelassgakhadnvapaifggftmvtnyeplevlhipid
Timeline for d1h74d1: