Lineage for d1h4ra2 (1h4r A:215-313)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378331Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 378341Protein Merlin [69294] (2 species)
    the neurofibromatosis 2 tumor suppressor protein
  7. 378342Species Human (Homo sapiens) [TaxId:9606] [69295] (1 PDB entry)
  8. 378343Domain d1h4ra2: 1h4r A:215-313 [65617]
    Other proteins in same PDB: d1h4ra1, d1h4ra3, d1h4rb1, d1h4rb3

Details for d1h4ra2

PDB Entry: 1h4r (more details), 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

SCOP Domain Sequences for d1h4ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens)}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrka

SCOP Domain Coordinates for d1h4ra2:

Click to download the PDB-style file with coordinates for d1h4ra2.
(The format of our PDB-style files is described here.)

Timeline for d1h4ra2: