![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.55: PH domain-like [50728] (1 superfamily) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (9 families) ![]() |
![]() | Family b.55.1.5: Third domain of FERM [50776] (6 proteins) |
![]() | Protein Merlin [69294] (2 species) the neurofibromatosis 2 tumor suppressor protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69295] (1 PDB entry) |
![]() | Domain d1h4ra2: 1h4r A:215-313 [65617] Other proteins in same PDB: d1h4ra1, d1h4ra3, d1h4rb1, d1h4rb3 |
PDB Entry: 1h4r (more details), 1.8 Å
SCOP Domain Sequences for d1h4ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens)} emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrrka
Timeline for d1h4ra2: