Lineage for d1h4ra3 (1h4r A:20-103)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 407835Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 407958Family d.15.1.4: First domain of FERM [54256] (5 proteins)
  6. 407968Protein Merlin [69660] (2 species)
    the neurofibromatosis 2 tumor suppressor protein
  7. 407969Species Human (Homo sapiens) [TaxId:9606] [69661] (1 PDB entry)
  8. 407970Domain d1h4ra3: 1h4r A:20-103 [65618]
    Other proteins in same PDB: d1h4ra1, d1h4ra2, d1h4rb1, d1h4rb2

Details for d1h4ra3

PDB Entry: 1h4r (more details), 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

SCOP Domain Sequences for d1h4ra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens)}
ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
kvldhdvskeepvtfhflakfype

SCOP Domain Coordinates for d1h4ra3:

Click to download the PDB-style file with coordinates for d1h4ra3.
(The format of our PDB-style files is described here.)

Timeline for d1h4ra3: