Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (23 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein Peroxiredoxin 5 [64066] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64067] (6 PDB entries) Uniprot P30044 |
Domain d1h4od_: 1h4o D: [65611] |
PDB Entry: 1h4o (more details), 1.95 Å
SCOP Domain Sequences for d1h4od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4od_ c.47.1.10 (D:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql
Timeline for d1h4od_: