Lineage for d1h4oh_ (1h4o H:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 834330Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 834494Protein Peroxiredoxin 5 [64066] (1 species)
  7. 834495Species Human (Homo sapiens) [TaxId:9606] [64067] (6 PDB entries)
    Uniprot P30044
  8. 834505Domain d1h4oh_: 1h4o H: [65615]
    complexed with bez

Details for d1h4oh_

PDB Entry: 1h4o (more details), 1.95 Å

PDB Description: Monoclinic form of human peroxiredoxin 5
PDB Compounds: (H:) peroxiredoxin 5

SCOP Domain Sequences for d1h4oh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4oh_ c.47.1.10 (H:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

SCOP Domain Coordinates for d1h4oh_:

Click to download the PDB-style file with coordinates for d1h4oh_.
(The format of our PDB-style files is described here.)

Timeline for d1h4oh_: