Lineage for d1h4od_ (1h4o D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699938Protein Peroxiredoxin 5 [64066] (1 species)
  7. 699939Species Human (Homo sapiens) [TaxId:9606] [64067] (4 PDB entries)
  8. 699945Domain d1h4od_: 1h4o D: [65611]

Details for d1h4od_

PDB Entry: 1h4o (more details), 1.95 Å

PDB Description: Monoclinic form of human peroxiredoxin 5
PDB Compounds: (D:) peroxiredoxin 5

SCOP Domain Sequences for d1h4od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4od_ c.47.1.10 (D:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

SCOP Domain Coordinates for d1h4od_:

Click to download the PDB-style file with coordinates for d1h4od_.
(The format of our PDB-style files is described here.)

Timeline for d1h4od_: