Lineage for d1guzb2 (1guz B:143-305)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139061Protein Malate dehydrogenase [56329] (10 species)
  7. 139076Species Chlorobium vibrioforme [TaxId:1098] [69842] (2 PDB entries)
  8. 139078Domain d1guzb2: 1guz B:143-305 [65589]
    Other proteins in same PDB: d1guza1, d1guzb1, d1guzc1, d1guzd1

Details for d1guzb2

PDB Entry: 1guz (more details), 2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

SCOP Domain Sequences for d1guzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guzb2 d.162.1.1 (B:143-305) Malate dehydrogenase {Chlorobium vibrioforme}
agvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvagipisdllpaetid
klvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpcavglegqygidkt
fvgvpvklgrngveqiyeinldqadldllqksakivdenckml

SCOP Domain Coordinates for d1guzb2:

Click to download the PDB-style file with coordinates for d1guzb2.
(The format of our PDB-style files is described here.)

Timeline for d1guzb2: