Lineage for d1guzd1 (1guz D:1-142)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118753Protein Malate dehydrogenase [51849] (10 species)
  7. 118768Species Chlorobium vibrioforme [TaxId:1098] [69417] (2 PDB entries)
  8. 118772Domain d1guzd1: 1guz D:1-142 [65592]
    Other proteins in same PDB: d1guza2, d1guzb2, d1guzc2, d1guzd2

Details for d1guzd1

PDB Entry: 1guz (more details), 2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
PDB Compounds: (D:)

SCOP Domain Sequences for d1guzd1:

Sequence, based on SEQRES records: (download)

>d1guzd1 c.2.1.5 (D:1-142) Malate dehydrogenase {Chlorobium vibrioforme}
mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
ldimthvawvrsglpkervigm

Sequence, based on observed residues (ATOM records): (download)

>d1guzd1 c.2.1.5 (D:1-142) Malate dehydrogenase {Chlorobium vibrioforme}
mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
sndyadtansdiviitaglllmknagivkevtdnimkhsknpiiivvsnpldimthvawv
rsglpkervigm

SCOP Domain Coordinates for d1guzd1:

Click to download the PDB-style file with coordinates for d1guzd1.
(The format of our PDB-style files is described here.)

Timeline for d1guzd1: