SCOP 1.63: Domain d1gpwd_: 1gpw D:

Lineage for d1gpwd_ (1gpw D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [69448] (3 PDB entries)

8. Domain d1gpwd_: 1gpw D: [65463]
   Other proteins in same PDB: d1gpwa_, d1gpwc_, d1gpwe_

Details for d1gpwd_

PDB Entry: 1gpw, 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

SCOP Domain Sequences for d1gpwd_:

Sequence; same for both SEQRES and ATOM records:

>d1gpwd_ c.23.16.1 (D:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr

Timeline for d1gpwd_:

• d1gpwd_ first appeared in SCOP 1.59
  
• d1gpwd_ appears in SCOP 1.61
  
• d1gpwd_ appears in SCOP 1.65
  
• d1gpwd_ appears in the current release, SCOPe 2.08