SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1gpwd_ (1gpw D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104319Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 protein domains)
    contains a catalytic Cys-His-Glu triad
  6. 2104394Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 2104404Species Thermotoga maritima [TaxId:2336] [69448] (6 PDB entries)
  8. 2104413Domain d1gpwd_: 1gpw D: [65463]
    Other proteins in same PDB: d1gpwa_, d1gpwc_, d1gpwe_
    complexed with po4

Details for d1gpwd_

PDB Entry: 1gpw (more details), 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.
PDB Compounds: (D:) amidotransferase hish

SCOPe Domain Sequences for d1gpwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpwd_ c.23.16.1 (D:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr

SCOPe Domain Coordinates for d1gpwd_:

Click to download the PDB-style file with coordinates for d1gpwd_.
(The format of our PDB-style files is described here.)

Timeline for d1gpwd_: