Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species) |
Species Thermotoga maritima [TaxId:2336] [51371] (12 PDB entries) |
Domain d1gpwc_: 1gpw C: [65462] Other proteins in same PDB: d1gpwb_, d1gpwd_, d1gpwf_ complexed with po4 |
PDB Entry: 1gpw (more details), 2.4 Å
SCOPe Domain Sequences for d1gpwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpwc_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey lkkhgvnvrlegl
Timeline for d1gpwc_: