SCOP 1.65: Domain d1gpwc_: 1gpw C:

Lineage for d1gpwc_ (1gpw C:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:243274] [51371] (2 PDB entries)

8. Domain d1gpwc_: 1gpw C: [65462]
   Other proteins in same PDB: d1gpwb_, d1gpwd_, d1gpwf_

Details for d1gpwc_

PDB Entry: 1gpw, 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

SCOP Domain Sequences for d1gpwc_:

Sequence; same for both SEQRES and ATOM records:

>d1gpwc_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

Timeline for d1gpwc_:

• d1gpwc_ first appeared in SCOP 1.59
  
• d1gpwc_ appears in SCOP 1.63
  
• d1gpwc_ appears in SCOP 1.67
  
• d1gpwc_ appears in the current release, SCOPe 2.08