Lineage for d1gpwc_ (1gpw C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305184Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 305185Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
    structural evidence for the gene duplication within the barrel fold
  6. 305186Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 305199Species Thermotoga maritima [TaxId:243274] [51371] (2 PDB entries)
  8. 305202Domain d1gpwc_: 1gpw C: [65462]
    Other proteins in same PDB: d1gpwb_, d1gpwd_, d1gpwf_

Details for d1gpwc_

PDB Entry: 1gpw (more details), 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

SCOP Domain Sequences for d1gpwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpwc_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

SCOP Domain Coordinates for d1gpwc_:

Click to download the PDB-style file with coordinates for d1gpwc_.
(The format of our PDB-style files is described here.)

Timeline for d1gpwc_: