Lineage for d1gpwf_ (1gpw F:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311797Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures
  5. 311798Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (6 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 311853Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 311863Species Thermotoga maritima [TaxId:243274] [69448] (3 PDB entries)
  8. 311867Domain d1gpwf_: 1gpw F: [65465]
    Other proteins in same PDB: d1gpwa_, d1gpwc_, d1gpwe_
    complexed with po4; mutant

Details for d1gpwf_

PDB Entry: 1gpw (more details), 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

SCOP Domain Sequences for d1gpwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpwf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr

SCOP Domain Coordinates for d1gpwf_:

Click to download the PDB-style file with coordinates for d1gpwf_.
(The format of our PDB-style files is described here.)

Timeline for d1gpwf_: