| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (6 proteins) contains a catalytic Cys-His-Glu triad |
| Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species) |
| Species Thermotoga maritima [TaxId:243274] [69448] (3 PDB entries) |
| Domain d1gpwf_: 1gpw F: [65465] Other proteins in same PDB: d1gpwa_, d1gpwc_, d1gpwe_ complexed with po4; mutant |
PDB Entry: 1gpw (more details), 2.4 Å
SCOP Domain Sequences for d1gpwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpwf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr
Timeline for d1gpwf_: