Lineage for d1gozb2 (1goz B:2122-2238)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189555Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 189556Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 189568Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 189569Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)
  8. 189576Domain d1gozb2: 1goz B:2122-2238 [65438]
    Other proteins in same PDB: d1goza1, d1gozb1

Details for d1gozb2

PDB Entry: 1goz (more details), 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant

SCOP Domain Sequences for d1gozb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gozb2 d.15.6.1 (B:2122-2238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

SCOP Domain Coordinates for d1gozb2:

Click to download the PDB-style file with coordinates for d1gozb2.
(The format of our PDB-style files is described here.)

Timeline for d1gozb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gozb1