SCOPe 2.08: Domain d1gozb2: 1goz B:2122-2238

Lineage for d1gozb2 (1goz B:2122-2238)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)

8. Domain d1gozb2: 1goz B:2122-2238 [65438]
   Other proteins in same PDB: d1goza1, d1gozb1
   mutant

Details for d1gozb2

PDB Entry: 1goz, 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant

PDB Compounds: (B:) enterotoxin type b

SCOPe Domain Sequences for d1gozb2:

Sequence; same for both SEQRES and ATOM records:

>d1gozb2 d.15.6.1 (B:2122-2238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

Timeline for d1gozb2:

• d1gozb2 first appeared in SCOP 1.59
  
• d1gozb2 appears in SCOPe 2.07