Lineage for d1gn8b_ (1gn8 B:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.3: Adenylyltransferase [52397] (3 proteins) Protein Phosphopantetheine adenylyltransferase [52398] (1 species) Species Escherichia coli [TaxId:562] [52399] (3 PDB entries) 
Domain d1gn8b_: 1gn8 B: [65396]
complexed with atp, mn, so4
Details for d1gn8b_
PDB Entry: 1gn8 (more details), 1.83 Å
PDB Description: phosphopantetheine adenylyltransferase in complex with mn2+atp from escherichia coli
SCOP Domain Sequences for d1gn8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gn8b_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla
SCOP Domain Coordinates for d1gn8b_:
Click to download the PDB-style file with coordinates for d1gn8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gn8b_:
- d1gn8b_ first appeared in SCOP 1.59
- d1gn8b_ appears in SCOP 1.61
- d1gn8b_ appears in SCOP 1.65
- d1gn8b_ appears in the current release, SCOPe 2.08
View in 3D
