Lineage for d1gn8b_ (1gn8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105663Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2105781Protein Phosphopantetheine adenylyltransferase [52398] (6 species)
  7. 2105784Species Escherichia coli [TaxId:562] [52399] (4 PDB entries)
  8. 2105792Domain d1gn8b_: 1gn8 B: [65396]
    complexed with atp, mn, so4

Details for d1gn8b_

PDB Entry: 1gn8 (more details), 1.83 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with mn2+atp from escherichia coli
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1gn8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gn8b_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d1gn8b_:

Click to download the PDB-style file with coordinates for d1gn8b_.
(The format of our PDB-style files is described here.)

Timeline for d1gn8b_: