Lineage for d1gn0a_ (1gn0 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180820Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
  4. 180821Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) (S)
  5. 180860Family c.46.1.3: Sulfurtransferase GlpE [69509] (1 protein)
  6. 180861Protein Sulfurtransferase GlpE [69510] (1 species)
  7. 180862Species Escherichia coli [TaxId:562] [69511] (2 PDB entries)
  8. 180864Domain d1gn0a_: 1gn0 A: [65358]

Details for d1gn0a_

PDB Entry: 1gn0 (more details), 1.8 Å

PDB Description: Escherichia coli GlpE sulfurtransferase soaked with KCN

SCOP Domain Sequences for d1gn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gn0a_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli}
mdqfecinvadahqklqekeavlvdirdpqsfamghavqafhltndtlgafmrdndfdtp
vmvmcyhgnsskgaaqyllqqgydvvysidggfeawqrqfpaevayga

SCOP Domain Coordinates for d1gn0a_:

Click to download the PDB-style file with coordinates for d1gn0a_.
(The format of our PDB-style files is described here.)

Timeline for d1gn0a_: