Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.3: Single-domain sulfurtransferase [69509] (3 proteins) |
Protein Sulfurtransferase GlpE [69510] (1 species) single-domain rhodanese |
Species Escherichia coli [TaxId:562] [69511] (2 PDB entries) |
Domain d1gn0a_: 1gn0 A: [65358] complexed with edo, na |
PDB Entry: 1gn0 (more details), 1.8 Å
SCOPe Domain Sequences for d1gn0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gn0a_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} mdqfecinvadahqklqekeavlvdirdpqsfamghavqafhltndtlgafmrdndfdtp vmvmcyhgnsskgaaqyllqqgydvvysidggfeawqrqfpaevayga
Timeline for d1gn0a_: