Lineage for d1gmvb1 (1gmv B:1-70)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430293Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
    barrel, closed; n=6, S=8; a crossover loop topology
  4. 2430294Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family) (S)
    automatically mapped to Pfam PF02814
  5. 2430295Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins)
  6. 2430296Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species)
  7. 2430300Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries)
  8. 2430310Domain d1gmvb1: 1gmv B:1-70 [65345]
    Other proteins in same PDB: d1gmva2, d1gmvb2

Details for d1gmvb1

PDB Entry: 1gmv (more details), 2.8 Å

PDB Description: structure of uree
PDB Compounds: (B:) uree

SCOPe Domain Sequences for d1gmvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmvb1 b.107.1.1 (B:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee
gtefvqviaa

SCOPe Domain Coordinates for d1gmvb1:

Click to download the PDB-style file with coordinates for d1gmvb1.
(The format of our PDB-style files is described here.)

Timeline for d1gmvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gmvb2