Class b: All beta proteins [48724] (178 folds) |
Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily) barrel, closed; n=6, S=8; a crossover loop topology |
Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family) automatically mapped to Pfam PF02814 |
Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins) |
Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species) |
Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries) |
Domain d1gmvb1: 1gmv B:1-70 [65345] Other proteins in same PDB: d1gmva2, d1gmvb2 |
PDB Entry: 1gmv (more details), 2.8 Å
SCOPe Domain Sequences for d1gmvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmvb1 b.107.1.1 (B:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes [TaxId: 28451]} mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee gtefvqviaa
Timeline for d1gmvb1: